Lineage for d1mczf2 (1mcz F:2-181)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361464Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1361488Protein Benzoylformate decarboxylase [88731] (1 species)
  7. 1361489Species Pseudomonas putida [TaxId:303] [88732] (10 PDB entries)
    Uniprot P20906
  8. 1361507Domain d1mczf2: 1mcz F:2-181 [78968]
    Other proteins in same PDB: d1mcza1, d1mcza3, d1mczb1, d1mczb3, d1mczc1, d1mczc3, d1mczd1, d1mczd3, d1mcze1, d1mcze3, d1mczf1, d1mczf3, d1mczg1, d1mczg3, d1mczh1, d1mczh3, d1mczi1, d1mczi3, d1mczj1, d1mczj3, d1mczk1, d1mczk3, d1mczl1, d1mczl3, d1mczm1, d1mczm3, d1mczn1, d1mczn3, d1mczo1, d1mczo3, d1mczp1, d1mczp3
    complexed with mg, rmn, tdp

Details for d1mczf2

PDB Entry: 1mcz (more details), 2.8 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate
PDB Compounds: (F:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d1mczf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mczf2 c.36.1.5 (F:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d1mczf2:

Click to download the PDB-style file with coordinates for d1mczf2.
(The format of our PDB-style files is described here.)

Timeline for d1mczf2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mcza1, d1mcza2, d1mcza3, d1mczb1, d1mczb2, d1mczb3, d1mczc1, d1mczc2, d1mczc3, d1mczd1, d1mczd2, d1mczd3, d1mcze1, d1mcze2, d1mcze3, d1mczg1, d1mczg2, d1mczg3, d1mczh1, d1mczh2, d1mczh3, d1mczi1, d1mczi2, d1mczi3, d1mczj1, d1mczj2, d1mczj3, d1mczk1, d1mczk2, d1mczk3, d1mczl1, d1mczl2, d1mczl3, d1mczm1, d1mczm2, d1mczm3, d1mczn1, d1mczn2, d1mczn3, d1mczo1, d1mczo2, d1mczo3, d1mczp1, d1mczp2, d1mczp3