Lineage for d1mc9a_ (1mc9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792072Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2792073Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2792212Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 2792213Species Streptomyces lividans [TaxId:1916] [74958] (3 PDB entries)
  8. 2792216Domain d1mc9a_: 1mc9 A: [78949]
    complexed with gol, so4

Details for d1mc9a_

PDB Entry: 1mc9 (more details), 1.7 Å

PDB Description: strepromyces lividans xylan binding domain cbm13 in complex with xylopentaose
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1mc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc9a_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]}
dggqikgvgsgrcldvpdastsdgtqlqlwdchsgtnqqwaatdagelrvygdkcldaag
tsngskvqiyscwggdnqkwrlnsdgsvvgvqsglcldavgngtangtliqlytcsngsn
qrwtrt

SCOPe Domain Coordinates for d1mc9a_:

Click to download the PDB-style file with coordinates for d1mc9a_.
(The format of our PDB-style files is described here.)

Timeline for d1mc9a_: