![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
![]() | Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (4 species) |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [81798] (1 PDB entry) |
![]() | Domain d1mc8a1: 1mc8 A:221-332 [78945] Other proteins in same PDB: d1mc8a2, d1mc8b2 |
PDB Entry: 1mc8 (more details), 3.1 Å
SCOP Domain Sequences for d1mc8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc8a1 a.60.7.1 (A:221-332) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus horikoshii} itreklielailvgtdynpggvkgigpkkaleivrysrdplakfqrqsdvdlyaikeffl nppvtneyslswkepdeegilkflcdehnfseervkngierlkkaikagrqs
Timeline for d1mc8a1: