Lineage for d1mc1b1 (1mc1 B:210-508)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312411Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 312412Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins)
  6. 312454Protein beta-Lactam synthetase [69456] (1 species)
    Asparagine synthetase B homologue
  7. 312455Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries)
  8. 312463Domain d1mc1b1: 1mc1 B:210-508 [78941]
    Other proteins in same PDB: d1mc1a2, d1mc1b2
    complexed with amp, mg, pcx, pop

Details for d1mc1b1

PDB Entry: 1mc1 (more details), 2.16 Å

PDB Description: beta-lactam synthetase with product (dgpc), amp and ppi

SCOP Domain Sequences for d1mc1b1:

Sequence, based on SEQRES records: (download)

>d1mc1b1 c.26.2.1 (B:210-508) beta-Lactam synthetase {Streptomyces clavuligerus}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg
sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

Sequence, based on observed residues (ATOM records): (download)

>d1mc1b1 c.26.2.1 (B:210-508) beta-Lactam synthetase {Streptomyces clavuligerus}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpkltssfs
rllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

SCOP Domain Coordinates for d1mc1b1:

Click to download the PDB-style file with coordinates for d1mc1b1.
(The format of our PDB-style files is described here.)

Timeline for d1mc1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc1b2