Lineage for d1mc1a2 (1mc1 A:5-209)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512791Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 512810Protein beta-Lactam synthetase [69831] (2 species)
    Asparagine synthetase B homologue
  7. 512820Species Streptomyces clavuligerus [TaxId:1901] [69832] (5 PDB entries)
  8. 512827Domain d1mc1a2: 1mc1 A:5-209 [78940]
    Other proteins in same PDB: d1mc1a1, d1mc1b1

Details for d1mc1a2

PDB Entry: 1mc1 (more details), 2.16 Å

PDB Description: beta-lactam synthetase with product (dgpc), amp and ppi

SCOP Domain Sequences for d1mc1a2:

Sequence, based on SEQRES records: (download)

>d1mc1a2 d.153.1.1 (A:5-209) beta-Lactam synthetase {Streptomyces clavuligerus}
vlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdravar
sltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatv
vrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltgv
yqvpagavmdidlgsgtavthrtwt

Sequence, based on observed residues (ATOM records): (download)

>d1mc1a2 d.153.1.1 (A:5-209) beta-Lactam synthetase {Streptomyces clavuligerus}
vlpaafgflasargpvfatrgshtdidtpqgerslaatlvhapsvapdravarsltgapt
tavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvvrtgdrv
llatdhagsvplytcvapgevrasteakalaagfpladarrvagltgvyqvpagavmdid
lgsgtavthrtwt

SCOP Domain Coordinates for d1mc1a2:

Click to download the PDB-style file with coordinates for d1mc1a2.
(The format of our PDB-style files is described here.)

Timeline for d1mc1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc1a1