![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins) |
![]() | Protein beta-Lactam synthetase [69456] (2 species) Asparagine synthetase B homologue |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries) |
![]() | Domain d1mc1a1: 1mc1 A:210-507 [78939] Other proteins in same PDB: d1mc1a2, d1mc1b2 |
PDB Entry: 1mc1 (more details), 2.16 Å
SCOP Domain Sequences for d1mc1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc1a1 c.26.2.1 (A:210-507) beta-Lactam synthetase {Streptomyces clavuligerus} pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadr
Timeline for d1mc1a1: