Lineage for d1mc1a1 (1mc1 A:210-507)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482696Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 482697Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 482744Protein beta-Lactam synthetase [69456] (2 species)
    Asparagine synthetase B homologue
  7. 482754Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries)
  8. 482761Domain d1mc1a1: 1mc1 A:210-507 [78939]
    Other proteins in same PDB: d1mc1a2, d1mc1b2

Details for d1mc1a1

PDB Entry: 1mc1 (more details), 2.16 Å

PDB Description: beta-lactam synthetase with product (dgpc), amp and ppi

SCOP Domain Sequences for d1mc1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc1a1 c.26.2.1 (A:210-507) beta-Lactam synthetase {Streptomyces clavuligerus}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg
sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadr

SCOP Domain Coordinates for d1mc1a1:

Click to download the PDB-style file with coordinates for d1mc1a1.
(The format of our PDB-style files is described here.)

Timeline for d1mc1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc1a2