Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins) |
Protein beta-Lactam synthetase [69456] (2 species) Asparagine synthetase B homologue |
Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries) |
Domain d1mbza1: 1mbz A:210-507 [78933] Other proteins in same PDB: d1mbza2, d1mbzb2 |
PDB Entry: 1mbz (more details), 2.47 Å
SCOP Domain Sequences for d1mbza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbza1 c.26.2.1 (A:210-507) beta-Lactam synthetase {Streptomyces clavuligerus} pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadr
Timeline for d1mbza1: