![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
![]() | Protein beta-Lactam synthetase [69456] (2 species) Asparagine synthetase B homologue |
![]() | Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries) |
![]() | Domain d1mbza1: 1mbz A:210-507 [78933] Other proteins in same PDB: d1mbza2, d1mbzb2 complexed with gol, iot, mg, pop has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1mbz (more details), 2.47 Å
SCOPe Domain Sequences for d1mbza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbza1 c.26.2.1 (A:210-507) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadr
Timeline for d1mbza1: