Lineage for d1mbza1 (1mbz A:210-507)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861311Protein beta-Lactam synthetase [69456] (2 species)
    Asparagine synthetase B homologue
  7. 2861321Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries)
  8. 2861330Domain d1mbza1: 1mbz A:210-507 [78933]
    Other proteins in same PDB: d1mbza2, d1mbzb2
    complexed with gol, iot, mg, pop
    has additional insertions and/or extensions that are not grouped together

Details for d1mbza1

PDB Entry: 1mbz (more details), 2.47 Å

PDB Description: beta-lactam synthetase with trapped intermediate
PDB Compounds: (A:) beta-lactam synthetase

SCOPe Domain Sequences for d1mbza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbza1 c.26.2.1 (A:210-507) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg
sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadr

SCOPe Domain Coordinates for d1mbza1:

Click to download the PDB-style file with coordinates for d1mbza1.
(The format of our PDB-style files is described here.)

Timeline for d1mbza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mbza2