Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (3 families) |
Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) |
Protein Adaptor protein ClpS (YljA) [82642] (1 species) |
Species Escherichia coli [TaxId:562] [82643] (8 PDB entries) |
Domain d1mbxd_: 1mbx D: [78930] Other proteins in same PDB: d1mbxa_, d1mbxb_ complex with ClpA N-domain complexed with cl, gol, ybt, zn |
PDB Entry: 1mbx (more details), 2.25 Å
SCOPe Domain Sequences for d1mbxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbxd_ d.45.1.2 (D:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev aetkvamvnkyarenehpllctleka
Timeline for d1mbxd_: