SCOPe 2.08: Domain d1mbvb_: 1mbv B:

Lineage for d1mbvb_ (1mbv B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)

7. Species Escherichia coli [TaxId:562] [82643] (8 PDB entries)

8. Domain d1mbvb_: 1mbv B: [78926]
   Other proteins in same PDB: d1mbva_
   complex with ClpA N-domain

Details for d1mbvb_

PDB Entry: 1mbv, 3.3 Å

PDB Description: crystal structure analysis of clpsn heterodimer tetragonal form

PDB Compounds: (B:) Protein yljA

SCOPe Domain Sequences for d1mbvb_:

Sequence; same for both SEQRES and ATOM records:

>d1mbvb_ d.45.1.2 (B:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

Timeline for d1mbvb_:

• d1mbvb_ first appeared in SCOP 1.63
  
• d1mbvb_ appears in SCOPe 2.07