![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
![]() | Superfamily d.45.1: ClpS-like [54736] (3 families) ![]() |
![]() | Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) |
![]() | Protein Adaptor protein ClpS (YljA) [82642] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [82643] (8 PDB entries) |
![]() | Domain d1mbvb_: 1mbv B: [78926] Other proteins in same PDB: d1mbva_ complex with ClpA N-domain |
PDB Entry: 1mbv (more details), 3.3 Å
SCOPe Domain Sequences for d1mbvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbvb_ d.45.1.2 (B:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev aetkvamvnkyarenehpllctleka
Timeline for d1mbvb_: