Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (2 families) |
Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein) |
Protein Adaptor protein ClpS (YljA) [82642] (1 species) |
Species Escherichia coli [TaxId:562] [82643] (7 PDB entries) |
Domain d1mbuc_: 1mbu C: [78923] Other proteins in same PDB: d1mbua_, d1mbub_ complex with ClpA N-domain |
PDB Entry: 1mbu (more details), 2.3 Å
SCOP Domain Sequences for d1mbuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbuc_ d.45.1.2 (C:) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev aetkvamvnkyarenehpllctleka
Timeline for d1mbuc_: