Lineage for d1mbmd_ (1mbm D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389767Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2389809Protein NSP4 proteinase [82128] (1 species)
    minimal fold; contains C-terminal extension
  7. 2389810Species Equine arteritis virus, EAV [TaxId:11047] [82129] (1 PDB entry)
  8. 2389814Domain d1mbmd_: 1mbm D: [78919]

Details for d1mbmd_

PDB Entry: 1mbm (more details), 2 Å

PDB Description: nsp4 proteinase from equine arteritis virus
PDB Compounds: (D:) chymotrypsin-like serine protease

SCOPe Domain Sequences for d1mbmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbmd_ b.47.1.3 (D:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]}
rgnvgfvagssygtgsvwtrnnevvvltashvvgranmatlkigdamltltfkkngdfae
avttqselpgnwpqlhfaqpttgpaswctatgdeegllsgevclawttsgdsgsavvqgd
avvgvhtgsntsgvayvttpsgkllgadtvtlsslskhftgpltsipkdipdniiadvda
vprslamlidglsnr

SCOPe Domain Coordinates for d1mbmd_:

Click to download the PDB-style file with coordinates for d1mbmd_.
(The format of our PDB-style files is described here.)

Timeline for d1mbmd_: