Lineage for d1mb9b2 (1mb9 B:3-209)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 419897Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)
    has slightly different topology than other families do
  6. 419916Protein beta-Lactam synthetase [69831] (2 species)
    Asparagine synthetase B homologue
  7. 419926Species Streptomyces clavuligerus [TaxId:1901] [69832] (5 PDB entries)
  8. 419932Domain d1mb9b2: 1mb9 B:3-209 [78915]
    Other proteins in same PDB: d1mb9a1, d1mb9b1
    complexed with amp, atp, mg, pop

Details for d1mb9b2

PDB Entry: 1mb9 (more details), 2.11 Å

PDB Description: beta-lactam synthetase complexed with atp

SCOP Domain Sequences for d1mb9b2:

Sequence, based on SEQRES records: (download)

>d1mb9b2 d.153.1.1 (B:3-209) beta-Lactam synthetase {Streptomyces clavuligerus}
apvlpaafgflasartgggrapgpvfatrgshtdidtpqgerslaatlvhapsvapdrav
arsltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfa
tvvrtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvaglt
gvyqvpagavmdidlgsgtavthrtwt

Sequence, based on observed residues (ATOM records): (download)

>d1mb9b2 d.153.1.1 (B:3-209) beta-Lactam synthetase {Streptomyces clavuligerus}
apvlpaafgflasartggpgpvfatrgshtdidtpqgerslaatlvhapsvapdravars
ltgapttavlageiynrdellsvlpagpapegdaelvlrllerydlhafrlvngrfatvv
rtgdrvllatdhagsvplytcvapgevrasteakalaahrdpkgfpladarrvagltgvy
qvpagavmdidlgsgtavthrtwt

SCOP Domain Coordinates for d1mb9b2:

Click to download the PDB-style file with coordinates for d1mb9b2.
(The format of our PDB-style files is described here.)

Timeline for d1mb9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mb9b1