SCOPe 2.08: Domain d1mb9b1: 1mb9 B:210-508

Lineage for d1mb9b1 (1mb9 B:210-508)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein beta-Lactam synthetase [69456] (2 species)
   Asparagine synthetase B homologue

7. Species Streptomyces clavuligerus [TaxId:1901] [69457] (5 PDB entries)

8. Domain d1mb9b1: 1mb9 B:210-508 [78914]
   Other proteins in same PDB: d1mb9a2, d1mb9b2
   complexed with amp, atp, mg, pop
   has additional insertions and/or extensions that are not grouped together

Details for d1mb9b1

PDB Entry: 1mb9, 2.11 Å

PDB Description: beta-lactam synthetase complexed with atp

PDB Compounds: (B:) beta-lactam synthetase

SCOPe Domain Sequences for d1mb9b1:

Sequence, based on SEQRES records:

>d1mb9b1 c.26.2.1 (B:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgvheg
sgttssfsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

Sequence, based on observed residues (ATOM records):

>d1mb9b1 c.26.2.1 (B:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]}
pglsrrilpegeavaavraalekavaqrvtpgdtplvvlsggidssgvaacahraageld
tvsmgtdtsnefrearavvdhlrtrhreitipttellaqlpyavwasesvdpdiieyllp
ltalyraldgperriltgygadiplggmhredrlpaldtvlahdmatfdglnemspvlst
laghwtthpywdrevldllvsleaglkrrhgrdkwvlraamadalpaetvnrpklgttss
fsrllldhgvaedrvheakrqvvrelfdltvgggrhpsevdtddvvrsvadrt

Timeline for d1mb9b1:

• d1mb9b1 first appeared in SCOP 1.63
  
• d1mb9b1 appears in SCOPe 2.07