Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species) |
Species Vibrio cholerae [TaxId:666] [82297] (4 PDB entries) |
Domain d1mb4b1: 1mb4 B:1-132,B:355-369 [78910] Other proteins in same PDB: d1mb4a2, d1mb4b2 complexed with cys, ndp |
PDB Entry: 1mb4 (more details), 1.84 Å
SCOPe Domain Sequences for d1mb4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mb4b1 c.2.1.3 (B:1-132,B:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh gihhgtktfvggXaaeplrrtlriilae
Timeline for d1mb4b1: