Lineage for d1mb4a2 (1mb4 A:133-354)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659010Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1659017Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 1659093Species Vibrio cholerae [TaxId:666] [82725] (4 PDB entries)
  8. 1659098Domain d1mb4a2: 1mb4 A:133-354 [78909]
    Other proteins in same PDB: d1mb4a1, d1mb4b1
    complexed with cys, ndp

Details for d1mb4a2

PDB Entry: 1mb4 (more details), 1.84 Å

PDB Description: crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with nadp and s-methyl-l-cysteine sulfoxide
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1mb4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
nctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgvindavsselanp
assildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqskeewkagveankil
glqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathndwvkvipnerdit
areltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwg

SCOPe Domain Coordinates for d1mb4a2:

Click to download the PDB-style file with coordinates for d1mb4a2.
(The format of our PDB-style files is described here.)

Timeline for d1mb4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mb4a1