Lineage for d1mb3a_ (1mb3 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586638Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1586642Protein Cell division response regulator DivK [82342] (1 species)
  7. 1586643Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries)
  8. 1586644Domain d1mb3a_: 1mb3 A: [78907]
    complexed with mg

Details for d1mb3a_

PDB Entry: 1mb3 (more details), 1.41 Å

PDB Description: crystal structure of the response regulator divk at ph 8.5 in complex with mg2+
PDB Compounds: (A:) cell division response regulator DivK

SCOPe Domain Sequences for d1mb3a_:

Sequence, based on SEQRES records: (download)

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle
rqp

Sequence, based on observed residues (ATOM records): (download)

>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtdeerireggceayiskpisvvhfletikrllerqp

SCOPe Domain Coordinates for d1mb3a_:

Click to download the PDB-style file with coordinates for d1mb3a_.
(The format of our PDB-style files is described here.)

Timeline for d1mb3a_: