Lineage for d1mb2e_ (1mb2 E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827435Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 827529Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 827530Species Bacillus stearothermophilus [TaxId:1422] [52379] (9 PDB entries)
  8. 827541Domain d1mb2e_: 1mb2 E: [78905]

Details for d1mb2e_

PDB Entry: 1mb2 (more details), 2.7 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase complexed with tryptophan in an open conformation
PDB Compounds: (E:) tryptophan-tRNA ligase

SCOP Domain Sequences for d1mb2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb2e_ c.26.1.1 (E:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1mb2e_:

Click to download the PDB-style file with coordinates for d1mb2e_.
(The format of our PDB-style files is described here.)

Timeline for d1mb2e_: