SCOP 1.71: Domain d1mb2d_: 1mb2 D:

Lineage for d1mb2d_ (1mb2 D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
   overall structure is similar to TyrRS

7. Species Bacillus stearothermophilus [TaxId:1422] [52379] (8 PDB entries)

8. Domain d1mb2d_: 1mb2 D: [78904]

Details for d1mb2d_

PDB Entry: 1mb2, 2.7 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase complexed with tryptophan in an open conformation

SCOP Domain Sequences for d1mb2d_:

Sequence; same for both SEQRES and ATOM records:

>d1mb2d_ c.26.1.1 (D:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

Timeline for d1mb2d_:

• d1mb2d_ first appeared in SCOP 1.63
  
• d1mb2d_ appears in SCOP 1.69
  
• d1mb2d_ appears in SCOP 1.73
  
• d1mb2d_ appears in the current release, SCOPe 2.08