Lineage for d1mb2b_ (1mb2 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693458Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 693459Species Bacillus stearothermophilus [TaxId:1422] [52379] (9 PDB entries)
  8. 693466Domain d1mb2b_: 1mb2 B: [78902]

Details for d1mb2b_

PDB Entry: 1mb2 (more details), 2.7 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase complexed with tryptophan in an open conformation
PDB Compounds: (B:) tryptophan-tRNA ligase

SCOP Domain Sequences for d1mb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb2b_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1mb2b_:

Click to download the PDB-style file with coordinates for d1mb2b_.
(The format of our PDB-style files is described here.)

Timeline for d1mb2b_: