Lineage for d1mb0a_ (1mb0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855429Protein Cell division response regulator DivK [82342] (1 species)
  7. 2855430Species Caulobacter crescentus [TaxId:155892] [82343] (5 PDB entries)
  8. 2855435Domain d1mb0a_: 1mb0 A: [78900]
    complexed with mn

Details for d1mb0a_

PDB Entry: 1mb0 (more details), 2 Å

PDB Description: crystal structure of the response regulator divk at ph 8.0 in complex with mn2+
PDB Compounds: (A:) cell division response regulator DivK

SCOPe Domain Sequences for d1mb0a_:

Sequence, based on SEQRES records: (download)

>d1mb0a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrlle

Sequence, based on observed residues (ATOM records): (download)

>d1mb0a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}
tkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisg
levtkwlkedddlahipvvavtggceayiskpisvvhfletikrlle

SCOPe Domain Coordinates for d1mb0a_:

Click to download the PDB-style file with coordinates for d1mb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1mb0a_: