SCOP 1.75: Domain d1mawe_: 1maw E:

Lineage for d1mawe_ (1maw E:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
   overall structure is similar to TyrRS

7. Species Bacillus stearothermophilus [TaxId:1422] [52379] (9 PDB entries)

8. Domain d1mawe_: 1maw E: [78898]

Details for d1mawe_

PDB Entry: 1maw, 3 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation

PDB Compounds: (E:) tryptophan-tRNA ligase

SCOP Domain Sequences for d1mawe_:

Sequence; same for both SEQRES and ATOM records:

>d1mawe_ c.26.1.1 (E:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

Timeline for d1mawe_:

• d1mawe_ first appeared in SCOP 1.63
  
• d1mawe_ appears in SCOP 1.73
  
• d1mawe_ appears in SCOPe 2.01
  
• d1mawe_ appears in the current release, SCOPe 2.08