Lineage for d1mawd_ (1maw D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312146Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 312147Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (11 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 312211Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (1 species)
    overall structure is similar to TyrRS
  7. 312212Species Bacillus stearothermophilus [TaxId:1422] [52379] (8 PDB entries)
  8. 312233Domain d1mawd_: 1maw D: [78897]

Details for d1mawd_

PDB Entry: 1maw (more details), 3 Å

PDB Description: crystal structure of tryptophanyl-trna synthetase complexed with atp in an open conformation

SCOP Domain Sequences for d1mawd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mawd_ c.26.1.1 (D:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1mawd_:

Click to download the PDB-style file with coordinates for d1mawd_.
(The format of our PDB-style files is described here.)

Timeline for d1mawd_: