SCOP 1.71: Domain d1ma9b2: 1ma9 B:147-371

Lineage for d1ma9b2 (1ma9 B:147-371)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)

8. Domain d1ma9b2: 1ma9 B:147-371 [78891]
   Other proteins in same PDB: d1ma9a1, d1ma9a2, d1ma9a3
   complexed with atp, mg, nem

Details for d1ma9b2

PDB Entry: 1ma9, 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin

SCOP Domain Sequences for d1ma9b2:

Sequence; same for both SEQRES and ATOM records:

>d1ma9b2 c.55.1.1 (B:147-371) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

Timeline for d1ma9b2:

• d1ma9b2 first appeared in SCOP 1.63
  
• d1ma9b2 appears in SCOP 1.69
  
• d1ma9b2 appears in SCOP 1.73
  
• d1ma9b2 appears in the current release, SCOPe 2.08