Lineage for d1ma9b1 (1ma9 B:5-146)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316626Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 316627Protein Actin [53073] (6 species)
  7. 316646Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (10 PDB entries)
  8. 316651Domain d1ma9b1: 1ma9 B:5-146 [78890]
    Other proteins in same PDB: d1ma9a1, d1ma9a2, d1ma9a3

Details for d1ma9b1

PDB Entry: 1ma9 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin

SCOP Domain Sequences for d1ma9b1:

Sequence, based on SEQRES records: (download)

>d1ma9b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1ma9b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOP Domain Coordinates for d1ma9b1:

Click to download the PDB-style file with coordinates for d1ma9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ma9b1: