Lineage for d1ma9a3 (1ma9 A:387-458)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281391Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1281392Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1281393Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1281703Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1281704Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1281716Domain d1ma9a3: 1ma9 A:387-458 [78889]
    Other proteins in same PDB: d1ma9b1, d1ma9b2
    complexed with atp, mg

Details for d1ma9a3

PDB Entry: 1ma9 (more details), 2.4 Å

PDB Description: Crystal structure of the complex of human vitamin D binding protein and rabbit muscle actin
PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1ma9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ma9a3 a.126.1.1 (A:387-458) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpeatptelaklvnkrsdfasnccsinspplyc
dseidaelknil

SCOPe Domain Coordinates for d1ma9a3:

Click to download the PDB-style file with coordinates for d1ma9a3.
(The format of our PDB-style files is described here.)

Timeline for d1ma9a3: