Lineage for d1ma3a_ (1ma3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107523Protein AF0112, Sir2 homolog (Sir2-AF2) [82380] (1 species)
  7. 2107524Species Archaeoglobus fulgidus [TaxId:2234] [82381] (3 PDB entries)
  8. 2107525Domain d1ma3a_: 1ma3 A: [78883]
    complexed with an acetylated p53 peptide, chain B
    complexed with mes, zn

Details for d1ma3a_

PDB Entry: 1ma3 (more details), 2 Å

PDB Description: Structure of a Sir2 enzyme bound to an acetylated p53 peptide
PDB Compounds: (A:) Transcriptional regulatory protein, Sir2 family

SCOPe Domain Sequences for d1ma3a_:

Sequence, based on SEQRES records: (download)

>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeoglobus fulgidus [TaxId: 2234]}
medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
kiveevkrlrse

Sequence, based on observed residues (ATOM records): (download)

>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeoglobus fulgidus [TaxId: 2234]}
medeirkaaeilakskhavvftgagisaeglwrkydpeevasisgfkrnprafwefsmem
kdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgsmdkldcldch
etydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaieeakhcdafmvv
gsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlpkiveevkrlr
se

SCOPe Domain Coordinates for d1ma3a_:

Click to download the PDB-style file with coordinates for d1ma3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ma3a_: