Lineage for d1m9za_ (1m9z A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259269Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2259309Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 2259312Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 2259313Domain d1m9za_: 1m9z A: [78881]
    complexed with gol

Details for d1m9za_

PDB Entry: 1m9z (more details), 1.05 Å

PDB Description: crystal structure of human tgf-beta type ii receptor ligand binding domain
PDB Compounds: (A:) TGF-beta receptor type II

SCOPe Domain Sequences for d1m9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9za_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
alckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpy
hdfiledaasptcimkekkkpgetffmcscssdecndniifseey

SCOPe Domain Coordinates for d1m9za_:

Click to download the PDB-style file with coordinates for d1m9za_.
(The format of our PDB-style files is described here.)

Timeline for d1m9za_: