Lineage for d1m9sa3 (1m9s A:466-551)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784971Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families) (S)
  5. 2784972Family b.34.11.1: GW domain [82058] (1 protein)
    automatically mapped to Pfam PF13457
  6. 2784973Protein Internalin B, C-terminal domains [82059] (1 species)
    duplication: tandem repeat of three SH3-like GW domains
  7. 2784974Species Listeria monocytogenes [TaxId:1639] [82060] (1 PDB entry)
  8. 2784976Domain d1m9sa3: 1m9s A:466-551 [78876]
    Other proteins in same PDB: d1m9sa1, d1m9sa5
    complexed with so4, tb

Details for d1m9sa3

PDB Entry: 1m9s (more details), 2.65 Å

PDB Description: Crystal structure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains.
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d1m9sa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9sa3 b.34.11.1 (A:466-551) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]}
rydkmeydkgvtayarvrnasgnsvwtkpyntagakhvnklsvyqgknmrilreaktpit
twyqfsiggkvigwvdtralntfykq

SCOPe Domain Coordinates for d1m9sa3:

Click to download the PDB-style file with coordinates for d1m9sa3.
(The format of our PDB-style files is described here.)

Timeline for d1m9sa3: