![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (5 families) ![]() |
![]() | Family b.34.11.1: GW domain [82058] (1 protein) automatically mapped to Pfam PF13457 |
![]() | Protein Internalin B, C-terminal domains [82059] (1 species) duplication: tandem repeat of three SH3-like GW domains |
![]() | Species Listeria monocytogenes [TaxId:1639] [82060] (1 PDB entry) |
![]() | Domain d1m9sa3: 1m9s A:466-551 [78876] Other proteins in same PDB: d1m9sa1, d1m9sa5 complexed with so4, tb |
PDB Entry: 1m9s (more details), 2.65 Å
SCOPe Domain Sequences for d1m9sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9sa3 b.34.11.1 (A:466-551) Internalin B, C-terminal domains {Listeria monocytogenes [TaxId: 1639]} rydkmeydkgvtayarvrnasgnsvwtkpyntagakhvnklsvyqgknmrilreaktpit twyqfsiggkvigwvdtralntfykq
Timeline for d1m9sa3:
![]() Domains from same chain: (mouse over for more information) d1m9sa1, d1m9sa2, d1m9sa4, d1m9sa5 |