![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins) truncated fold fused to an LRR domain |
![]() | Protein Internalin B [69172] (1 species) |
![]() | Species Listeria monocytogenes [TaxId:1639] [69173] (2 PDB entries) |
![]() | Domain d1m9sa1: 1m9s A:241-319 [78874] Other proteins in same PDB: d1m9sa2, d1m9sa3, d1m9sa4, d1m9sa5 complexed with so4, tb |
PDB Entry: 1m9s (more details), 2.65 Å
SCOPe Domain Sequences for d1m9sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9sa1 b.1.18.15 (A:241-319) Internalin B {Listeria monocytogenes [TaxId: 1639]} eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq pvtigkakarfhgrvtqpl
Timeline for d1m9sa1:
![]() Domains from same chain: (mouse over for more information) d1m9sa2, d1m9sa3, d1m9sa4, d1m9sa5 |