Lineage for d1m9nb2 (1m9n B:201-593)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2147972Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2147973Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 2147974Species Chicken (Gallus gallus) [TaxId:9031] [64200] (9 PDB entries)
    Uniprot P31335
  8. 2147980Domain d1m9nb2: 1m9n B:201-593 [78873]
    Other proteins in same PDB: d1m9na1, d1m9nb1
    complexed with amz, k, xmp

Details for d1m9nb2

PDB Entry: 1m9n (more details), 1.93 Å

PDB Description: crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.
PDB Compounds: (B:) aicar transformylase-imp cyclohydrolase

SCOPe Domain Sequences for d1m9nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9nb2 c.97.1.4 (B:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOPe Domain Coordinates for d1m9nb2:

Click to download the PDB-style file with coordinates for d1m9nb2.
(The format of our PDB-style files is described here.)

Timeline for d1m9nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m9nb1