SCOP 1.69: Domain d1m9nb1: 1m9n B:4-200

Lineage for d1m9nb1 (1m9n B:4-200)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)
   contains a common phosphate-binding site

5. Family c.24.1.3: Inosicase [63971] (1 protein)

6. Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [63973] (4 PDB entries)

8. Domain d1m9nb1: 1m9n B:4-200 [78872]
   Other proteins in same PDB: d1m9na2, d1m9nb2

Details for d1m9nb1

PDB Entry: 1m9n, 1.93 Å

PDB Description: crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.

SCOP Domain Sequences for d1m9nb1:

Sequence; same for both SEQRES and ATOM records:

>d1m9nb1 c.24.1.3 (B:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus)}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk

Timeline for d1m9nb1:

• d1m9nb1 first appeared in SCOP 1.63
  
• d1m9nb1 appears in SCOP 1.67
  
• d1m9nb1 appears in SCOP 1.71
  
• d1m9nb1 appears in the current release, SCOPe 2.08