Lineage for d1m9na2 (1m9n A:201-593)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 251301Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 251318Superfamily c.97.2: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64197] (1 family) (S)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  5. 251319Family c.97.2.1: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
  6. 251320Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (1 species)
  7. 251321Species Chicken (Gallus gallus) [TaxId:9031] [64200] (2 PDB entries)
  8. 251324Domain d1m9na2: 1m9n A:201-593 [78871]
    Other proteins in same PDB: d1m9na1, d1m9nb1

Details for d1m9na2

PDB Entry: 1m9n (more details), 1.93 Å

PDB Description: crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with aicar and xmp at 1.93 angstroms.

SCOP Domain Sequences for d1m9na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9na2 c.97.2.1 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus)}
gvsqlplrygmnphqspaqlyttrpklpltvvngspgfinlcdalnawqlvkelkqalgi
paaasfkhvspagaavgiplseeeaqvcmvhdlhktltplasayarsrgadrmssfgdfi
alsdicdvptakiisrevsdgvvapgyeeealkilskkknggycvlqmdpnyepddneir
tlyglqlmqkrnnavidrslfknivtknktlpesavrdlivasiavkytqsnsvcyakdg
qvigigagqqsrihctrlagdkanswwlrhhprvlsmkfkagvkraevsnaidqyvtgti
gededlvkwqamfeevpaqlteaekkqwiakltavslssdaffpfrdnvdrakrigvqfi
vapsgsaadevvieacnelgitlihtnlrlfhh

SCOP Domain Coordinates for d1m9na2:

Click to download the PDB-style file with coordinates for d1m9na2.
(The format of our PDB-style files is described here.)

Timeline for d1m9na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m9na1