Lineage for d1m98a2 (1m98 A:176-317)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020387Family d.17.4.6: Orange carotenoid protein, C-terminal domain [82598] (1 protein)
  6. 1020388Protein Orange carotenoid protein, C-terminal domain [82599] (1 species)
  7. 1020389Species Arthrospira maxima [TaxId:129910] [82600] (1 PDB entry)
  8. 1020390Domain d1m98a2: 1m98 A:176-317 [78867]
    Other proteins in same PDB: d1m98a1, d1m98b1
    complexed with cl, heq, suc

Details for d1m98a2

PDB Entry: 1m98 (more details), 2.1 Å

PDB Description: crystal structure of orange carotenoid protein
PDB Compounds: (A:) Orange Carotenoid Protein

SCOPe Domain Sequences for d1m98a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Arthrospira maxima [TaxId: 129910]}
epvvppqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivg
kentlrffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrflln
penkvffvaidllaspkellnl

SCOPe Domain Coordinates for d1m98a2:

Click to download the PDB-style file with coordinates for d1m98a2.
(The format of our PDB-style files is described here.)

Timeline for d1m98a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m98a1