Lineage for d1m90w_ (1m90 W:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276876Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 276877Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 276878Protein Ribosomal protein L29 (L29p) [46563] (1 species)
  7. 276879Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (12 PDB entries)
  8. 276881Domain d1m90w_: 1m90 W: [78861]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90w_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1m90w_:

Click to download the PDB-style file with coordinates for d1m90w_.
(The format of our PDB-style files is described here.)

Timeline for d1m90w_: