Lineage for d1m90u_ (1m90 U:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784287Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1784330Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 1784370Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
    Uniprot P10972
  8. 1784390Domain d1m90u_: 1m90 U: [78859]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90u_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
PDB Compounds: (U:) ribosomal protein l24

SCOPe Domain Sequences for d1m90u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1m90u_:

Click to download the PDB-style file with coordinates for d1m90u_.
(The format of our PDB-style files is described here.)

Timeline for d1m90u_: