| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) ![]() |
| Family d.12.1.1: L23p [54190] (1 protein) |
| Protein Ribosomal protein L23 [54191] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (8 PDB entries) |
| Domain d1m90t_: 1m90 T: [78858] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOP Domain Sequences for d1m90t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri
Timeline for d1m90t_:
View in 3DDomains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |