Lineage for d1m90o_ (1m90 O:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495356Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2495357Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2495358Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2495398Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 2495416Domain d1m90o_: 1m90 O: [78853]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90o_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
PDB Compounds: (O:) ribosomal protein l18

SCOPe Domain Sequences for d1m90o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1m90o_:

Click to download the PDB-style file with coordinates for d1m90o_.
(The format of our PDB-style files is described here.)

Timeline for d1m90o_: