| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
| Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
| Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
| Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries) Uniprot P14123 |
| Domain d1m90o_: 1m90 O: [78853] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOPe Domain Sequences for d1m90o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90o_ c.55.4.1 (O:) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel
Timeline for d1m90o_:
View in 3DDomains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |