Lineage for d1m90n_ (1m90 N:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253778Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 253779Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 253791Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 253792Protein Ribosomal protein L15e [54194] (1 species)
  7. 253793Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (8 PDB entries)
  8. 253795Domain d1m90n_: 1m90 N: [78852]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90n_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90n_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1m90n_:

Click to download the PDB-style file with coordinates for d1m90n_.
(The format of our PDB-style files is described here.)

Timeline for d1m90n_: