Lineage for d1m90i_ (1m90 I:)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1472006Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 1472007Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 1472008Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 1472009Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 1472010Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
    Uniprot P15825
  8. 1472030Domain d1m90i_: 1m90 I: [78847]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90i_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1m90i_:

Sequence, based on SEQRES records: (download)

>d1m90i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1m90i_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOPe Domain Coordinates for d1m90i_:

Click to download the PDB-style file with coordinates for d1m90i_.
(The format of our PDB-style files is described here.)

Timeline for d1m90i_: