Lineage for d1m90g1 (1m90 G:1-79)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334675Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 334676Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 334677Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 334678Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 334679Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (12 PDB entries)
  8. 334682Domain d1m90g1: 1m90 G:1-79 [78844]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_

Details for d1m90g1

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m90g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m90g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1m90g1:

Click to download the PDB-style file with coordinates for d1m90g1.
(The format of our PDB-style files is described here.)

Timeline for d1m90g1: