SCOPe 2.07: Domain d1m90e_: 1m90 E:

Lineage for d1m90e_ (1m90 E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)
   automatically mapped to Pfam PF00573

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries)
   Uniprot P12735

8. Domain d1m90e_: 1m90 E: [78842]
   Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90c2, d1m90d_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
   complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m90e_

PDB Entry: 1m90, 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

PDB Compounds: (E:) ribosomal protein l4

SCOPe Domain Sequences for d1m90e_:

Sequence; same for both SEQRES and ATOM records:

>d1m90e_ c.22.1.1 (E:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

Timeline for d1m90e_:

• d1m90e_ first appeared in SCOP 1.63
  
• d1m90e_ appears in SCOPe 2.06
  
• d1m90e_ appears in the current release, SCOPe 2.08