| Class b: All beta proteins [48724] (165 folds) |
| Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
| Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) incomplete OB-fold lacking the last strand |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) includes the N-terminal tail |
| Domain d1m90c2: 1m90 C:1-90 [78840] Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m904_, d1m90c1, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ complexed with aca, cd, cl, k, mg, na, pha, sps |
PDB Entry: 1m90 (more details), 2.8 Å
SCOP Domain Sequences for d1m90c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m90c2 b.40.4.5 (C:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap
Timeline for d1m90c2:
View in 3DDomains from other chains: (mouse over for more information) d1m901_, d1m902_, d1m903_, d1m904_, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_ |