Lineage for d1m904_ (1m90 4:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271305Fold g.41: Rubredoxin-like [57769] (10 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 271530Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (3 families) (S)
  5. 271553Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 271554Protein Ribosomal protein L44e [57837] (1 species)
  7. 271555Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (8 PDB entries)
  8. 271557Domain d1m904_: 1m90 4: [78838]
    Other proteins in same PDB: d1m901_, d1m902_, d1m903_, d1m90c1, d1m90c2, d1m90d_, d1m90e_, d1m90f_, d1m90g1, d1m90g2, d1m90h_, d1m90i_, d1m90j_, d1m90k_, d1m90l_, d1m90m_, d1m90n_, d1m90o_, d1m90p_, d1m90q_, d1m90r_, d1m90s_, d1m90t_, d1m90u_, d1m90v_, d1m90w_, d1m90x_, d1m90y_, d1m90z_
    complexed with aca, cd, cl, k, mg, na, pha, sps

Details for d1m904_

PDB Entry: 1m90 (more details), 2.8 Å

PDB Description: co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit

SCOP Domain Sequences for d1m904_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m904_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1m904_:

Click to download the PDB-style file with coordinates for d1m904_.
(The format of our PDB-style files is described here.)

Timeline for d1m904_: