Lineage for d1m8wb_ (1m8w B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 285030Family a.118.1.8: Pumilio repeat [63611] (1 protein)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 285031Protein Pumilio 1 [63612] (1 species)
  7. 285032Species Human (Homo sapiens) [TaxId:9606] [63613] (5 PDB entries)
  8. 285036Domain d1m8wb_: 1m8w B: [78829]

Details for d1m8wb_

PDB Entry: 1m8w (more details), 2.2 Å

PDB Description: crystal structure of the pumilio-homology domain from human pumilio1 in complex with nre1-19 rna

SCOP Domain Sequences for d1m8wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8wb_ a.118.1.8 (B:) Pumilio 1 {Human (Homo sapiens)}
grsrlledfrnnrypnlqlreiaghimefsqdqhgsrfiqlkleratpaerqlvfneilq
aayqlmvdvfgnyviqkffefgsleqklalaerirghvlslalqmygcrviqkalefips
dqqnemvreldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfalsthpygc
rviqrilehclpdqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivaeirg
nvlvlsqhkfasnvvekcvthasrteravlidevctmndgphsalytmmkdqyanyvvqk
midvaepgqrkivmhkirphiatlrkytygkhilaklekyy

SCOP Domain Coordinates for d1m8wb_:

Click to download the PDB-style file with coordinates for d1m8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1m8wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m8wa_