Lineage for d1m8vg_ (1m8v G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396393Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2396504Species Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 2396539Domain d1m8vg_: 1m8v G: [78820]
    Other proteins in same PDB: d1m8va2
    complexed with a uridine heptamer
    protein/RNA complex; complexed with ca, u

Details for d1m8vg_

PDB Entry: 1m8v (more details), 2.6 Å

PDB Description: structure of pyrococcus abyssii sm protein in complex with a uridine heptamer
PDB Compounds: (G:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1m8vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8vg_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Pyrococcus abyssi [TaxId: 29292]}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOPe Domain Coordinates for d1m8vg_:

Click to download the PDB-style file with coordinates for d1m8vg_.
(The format of our PDB-style files is described here.)

Timeline for d1m8vg_: