Lineage for d1m8vg_ (1m8v G:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798180Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 798181Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 798292Species Archaeon Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 798327Domain d1m8vg_: 1m8v G: [78820]
    complexed with a uridine heptamer

Details for d1m8vg_

PDB Entry: 1m8v (more details), 2.6 Å

PDB Description: structure of pyrococcus abyssii sm protein in complex with a uridine heptamer
PDB Compounds: (G:) putative snrnp sm-like protein

SCOP Domain Sequences for d1m8vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8vg_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOP Domain Coordinates for d1m8vg_:

Click to download the PDB-style file with coordinates for d1m8vg_.
(The format of our PDB-style files is described here.)

Timeline for d1m8vg_: