| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries) |
| Domain d1m8va_: 1m8v A: [78814] complexed with a uridine heptamer protein/RNA complex; complexed with ca, u |
PDB Entry: 1m8v (more details), 2.6 Å
SCOPe Domain Sequences for d1m8va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8va_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Pyrococcus abyssi [TaxId: 29292]}
aerpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkiv
irgdnvlaispt
Timeline for d1m8va_: