Lineage for d1m8sa_ (1m8s A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217995Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 217996Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 218001Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 218072Protein Snake phospholipase A2 [48624] (19 species)
  7. 218078Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)
  8. 218082Domain d1m8sa_: 1m8s A: [78813]
    complexed with bu1, cd

Details for d1m8sa_

PDB Entry: 1m8s (more details), 1.9 Å

PDB Description: Crystal Structures of Cadmium-binding Acidic Phospholipase A2 from the Venom of Agkistrodon halys pallas at 1.9 Resolution (crystal grown at pH 5.9)

SCOP Domain Sequences for d1m8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8sa_ a.133.1.2 (A:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk
mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee
sepc

SCOP Domain Coordinates for d1m8sa_:

Click to download the PDB-style file with coordinates for d1m8sa_.
(The format of our PDB-style files is described here.)

Timeline for d1m8sa_: