Class a: All alpha proteins [46456] (171 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulphide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (19 species) |
Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries) |
Domain d1m8sa_: 1m8s A: [78813] complexed with bu1, cd |
PDB Entry: 1m8s (more details), 1.9 Å
SCOP Domain Sequences for d1m8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m8sa_ a.133.1.2 (A:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms} slvqfetlimkvakksgmqwysnygcycgwggqgrpqdatdrccfvhdccygkvtgcdpk mdvysfseengdivcggddpckkeicecdraaaicfrdnlntyndkkywafgakncpqee sepc
Timeline for d1m8sa_: